Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.
07:34
8775 59d2 500

hardyness:

Beauty and the beast cast → Emma Watson about filming the sequence of “Be our guest”:

In this scene, it was literally me sitting at an empty table seven days just looking at nothing it was the most boring thing I’ve ever had. 

Reposted byilovemoviesmoviesssnodifferencechlodnawdowafranklymydearunmadebedswecouldbeclosekoszmareknokturnaltelefonschroedingeraoutoflovelittlewhiteliestamarkamycelinemidnightloveraltopaltoasylopathtimmoeyoungiebuffyrulezskrzacikmadadreamofbitchesandbutterfliesblackheartgirl

Don't be the product, buy the product!

Schweinderl